Catalog No: AVARP13020_P050
Price: $0.00
SKU
AVARP13020_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CHRNB2 (AVARP13020_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CHRNB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CHRNB2 (AVARP13020_P050) antibody is Catalog # AAP30677 (Previous Catalog # AAPP01334)
Subunitbeta-2
ReferenceFeng,Y., et al., (2004) Am. J. Hum. Genet. 75 (1), 112-121
Gene SymbolCHRNB2
Gene Full NameCholinergic receptor, nicotinic, beta 2 (neuronal)
Alias SymbolsEFNL3, nAChRB2
NCBI Gene Id1141
Protein NameNeuronal acetylcholine receptor subunit beta-2
Description of TargetCHRNB2 is a neuronal nicotinic acetylcholine receptor (nAChR) that belong to ligand-gated ion channels composed of alpha and beta subunits with specific structural, functional and pharmacological properties.
Uniprot IDP17787
Protein Accession #NP_000739
Nucleotide Accession #NM_000748
Protein Size (# AA)502
Molecular Weight57kDa
Protein InteractionsCRELD2; CHRNA4; CHRNA2;
  1. What is the species homology for "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Pig, Zebrafish".

  2. How long will it take to receive "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    This target may also be called "EFNL3, nAChRB2" in publications.

  5. What is the shipping cost for "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHRNB2 Antibody - N-terminal region (AVARP13020_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHRNB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHRNB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHRNB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHRNB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHRNB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHRNB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHRNB2 Antibody - N-terminal region (AVARP13020_P050)
Your Rating