Search Antibody, Protein, and ELISA Kit Solutions

CHRNA9 Antibody - N-terminal region (AVARP13019_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP13019_P050-FITC Conjugated

AVARP13019_P050-HRP Conjugated

AVARP13019_P050-Biotin Conjugated

Gene Symbol:
CHRNA9
Official Gene Full Name:
Cholinergic receptor, nicotinic, alpha 9 (neuronal)
NCBI Gene Id:
55584
Protein Name:
Neuronal acetylcholine receptor subunit alpha-9
Swissprot Id:
Q9UGM1
Protein Accession #:
NP_060051
Nucleotide Accession #:
NM_017581
Alias Symbols:
NACHRA9, HSA243342
Replacement Item:
This antibody may replace item sc-13804 from Santa Cruz Biotechnology.
Description of Target:
CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
Protein Size (# AA):
479
Molecular Weight:
55kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHRNA9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHRNA9.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80%
Complete computational species homology data:
Anti-CHRNA9 (AVARP13019_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; Rapsn;
Blocking Peptide:
For anti-CHRNA9 (AVARP13019_P050) antibody is Catalog # AAP30675 (Previous Catalog # AAPP01332)
Datasheets/Manuals:
Printable datasheet for anti-CHRNA9 (AVARP13019_P050) antibody
Subunit:
alpha-9
Target Reference:
Peng,H., et al., (2004) Life Sci. 76 (3), 263-280
Publications:

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, -alpha9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). WB, Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish 24668500

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...