Size:100 ul
$319.00
In Stock
SKU
AVARP13019_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP13019_P050-FITC Conjugated

AVARP13019_P050-HRP Conjugated

AVARP13019_P050-Biotin Conjugated

CHRNA9 Antibody - N-terminal region (AVARP13019_P050)

Catalog#: AVARP13019_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13804 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80%
Complete computational species homology data Anti-CHRNA9 (AVARP13019_P050)
Peptide Sequence Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CHRNA9 (AVARP13019_P050) antibody is Catalog # AAP30675 (Previous Catalog # AAPP01332)
Datasheets/Manuals Printable datasheet for anti-CHRNA9 (AVARP13019_P050) antibody
Subunit alpha-9
Target Reference Peng,H., et al., (2004) Life Sci. 76 (3), 263-280
Publications

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, -alpha9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). WB, Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish 24668500

Gene Symbol CHRNA9
Official Gene Full Name Cholinergic receptor, nicotinic, alpha 9 (neuronal)
Alias Symbols NACHRA9, HSA243342
NCBI Gene Id 55584
Protein Name Neuronal acetylcholine receptor subunit alpha-9
Description of Target CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
Swissprot Id Q9UGM1
Protein Accession # NP_060051
Nucleotide Accession # NM_017581
Protein Size (# AA) 479
Molecular Weight 55kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHRNA9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHRNA9.
Protein Interactions UBC; Rapsn;
  1. What is the species homology for "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish".

  2. How long will it take to receive "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    This target may also be called "NACHRA9, HSA243342" in publications.

  5. What is the shipping cost for "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHRNA9 Antibody - N-terminal region (AVARP13019_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CHRNA9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHRNA9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHRNA9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHRNA9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHRNA9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHRNA9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHRNA9 Antibody - N-terminal region (AVARP13019_P050)
Your Rating
We found other products you might like!