Size:100 ul
$319.00
In stock
SKU
AVARP13019_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP13019_P050-FITC Conjugated

AVARP13019_P050-HRP Conjugated

AVARP13019_P050-Biotin Conjugated

CHRNA9 Antibody - N-terminal region (AVARP13019_P050)

Catalog#: AVARP13019_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-13804 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80%
Complete computational species homology dataAnti-CHRNA9 (AVARP13019_P050)
Peptide SequenceSynthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CHRNA9 (AVARP13019_P050) antibody is Catalog # AAP30675 (Previous Catalog # AAPP01332)
Datasheets/ManualsPrintable datasheet for anti-CHRNA9 (AVARP13019_P050) antibody
Subunitalpha-9
Target ReferencePeng,H., et al., (2004) Life Sci. 76 (3), 263-280
Publications

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, -alpha9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). WB, Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish 24668500

Gene SymbolCHRNA9
Official Gene Full NameCholinergic receptor, nicotinic, alpha 9 (neuronal)
Alias SymbolsNACHRA9, HSA243342
NCBI Gene Id55584
Protein NameNeuronal acetylcholine receptor subunit alpha-9
Description of TargetCHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
Swissprot IdQ9UGM1
Protein Accession #NP_060051
Nucleotide Accession #NM_017581
Protein Size (# AA)479
Molecular Weight55kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CHRNA9.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CHRNA9.
Protein InteractionsUBC; Rapsn;
Write Your Own Review
You're reviewing:CHRNA9 Antibody - N-terminal region (AVARP13019_P050)
Your Rating
Aviva Pathways
Assay Development
Aviva Live Chat
Aviva Travel Grant