Catalog No: AVARP13018_T100
Price: $0.00
SKU
AVARP13018_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CHRNA7 (AVARP13018_T100) antibody
Product Info
ReferenceAvramopoulou,V., et al., (2004) J. Biol. Chem. 279 (37), 38287-38293
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
Concentration1.0 mg/ml
Blocking PeptideFor anti-CHRNA7 (AVARP13018_T100) antibody is Catalog # AAP30674 (Previous Catalog # AAPP01331)
Subunitalpha-7
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Gene SymbolCHRNA7
Gene Full NameCholinergic receptor, nicotinic, alpha 7 (neuronal)
Alias SymbolsNACHRA7, CHRNA7-2
NCBI Gene Id1139
Protein NameNeuronal acetylcholine receptor subunit alpha-7
Description of TargetThe nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA7 is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from CHRNA7 and a novel FAM7A gene.
Uniprot IDP36544
Protein Accession #NP_000737
Nucleotide Accession #NM_000746
Protein Size (# AA)502
Molecular Weight56 kDa
Protein InteractionsATXN1; ADCY6; PIK3R1; APP; FYN;
  1. What is the species homology for "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow".

  2. How long will it take to receive "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    This target may also be called "NACHRA7, CHRNA7-2" in publications.

  5. What is the shipping cost for "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHRNA7 Antibody - N-terminal region (AVARP13018_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHRNA7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHRNA7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHRNA7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHRNA7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHRNA7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHRNA7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHRNA7 Antibody - N-terminal region (AVARP13018_T100)
Your Rating
We found other products you might like!