Loading...
Catalog No: ARP34965_P050
Price: $0.00
SKU
ARP34965_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CHRNA4 (ARP34965_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
Concentration0.5 mg/ml
Blocking PeptideFor anti-CHRNA4 (ARP34965_P050) antibody is Catalog # AAP34965 (Previous Catalog # AAPP06188)
Subunitalpha-4
ReferenceFedi,M., (2008) J. Clin. Endocrinol. Metab. 93 (2), 634-637
Publications

Ishizuka, T., Ozawa, A., Goshima, H. & Watanabe, Y. Involvement of nicotinic acetylcholine receptor in the proliferation of mouse induced pluripotent stem cells. Life Sci. 90, 637-48 (2012). 22483693

Gene SymbolCHRNA4
Gene Full NameCholinergic receptor, nicotinic, alpha 4 (neuronal)
Alias SymbolsEBN, BFNC, EBN1, NACHR, NACRA4, NACHRA4
NCBI Gene Id1137
Protein NameNeuronal acetylcholine receptor subunit alpha-4
Description of TargetCHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP43681
Protein Accession #NP_000735
Nucleotide Accession #NM_000744
Protein Size (# AA)627
Molecular Weight67kDa
Protein InteractionsUbqln1; CSNK2B; VSNL1; CHRNB4; CHRNB2; YWHAH; CRELD2;
  1. What is the species homology for "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHRNA4 Antibody - N-terminal region (ARP34965_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    This target may also be called "EBN, BFNC, EBN1, NACHR, NACRA4, NACHRA4" in publications.

  5. What is the shipping cost for "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHRNA4 Antibody - N-terminal region (ARP34965_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHRNA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHRNA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHRNA4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHRNA4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHRNA4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHRNA4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHRNA4 Antibody - N-terminal region (ARP34965_P050)
Your Rating
We found other products you might like!