Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP34965_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34965_P050-FITC Conjugated

ARP34965_P050-HRP Conjugated

ARP34965_P050-Biotin Conjugated

CHRNA4 Antibody - N-terminal region (ARP34965_P050)

Catalog#: ARP34965_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1772 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-CHRNA4 (ARP34965_P050)
Peptide Sequence Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CHRNA4 (ARP34965_P050) antibody is Catalog # AAP34965 (Previous Catalog # AAPP06188)
Datasheets/Manuals Printable datasheet for anti-CHRNA4 (ARP34965_P050) antibody
Subunit alpha-4
Target Reference Fedi,M., (2008) J. Clin. Endocrinol. Metab. 93 (2), 634-637
Publications

Ishizuka, T., Ozawa, A., Goshima, H. & Watanabe, Y. Involvement of nicotinic acetylcholine receptor in the proliferation of mouse induced pluripotent stem cells. Life Sci. 90, 637-48 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22483693

Gene Symbol CHRNA4
Official Gene Full Name Cholinergic receptor, nicotinic, alpha 4 (neuronal)
Alias Symbols BFNC, EBN, EBN1, NACRA4, NACHR, NACHRA4
NCBI Gene Id 1137
Protein Name Neuronal acetylcholine receptor subunit alpha-4
Description of Target CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P43681
Protein Accession # NP_000735
Nucleotide Accession # NM_000744
Protein Size (# AA) 627
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHRNA4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHRNA4.
Protein Interactions Ubqln1; CSNK2B; VSNL1; CHRNB4; CHRNB2; YWHAH; CRELD2;
Write Your Own Review
You're reviewing:CHRNA4 Antibody - N-terminal region (ARP34965_P050)
Your Rating