Search Antibody, Protein, and ELISA Kit Solutions

CHRNA4 antibody - N-terminal region (ARP34965_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34965_P050-FITC Conjugated

ARP34965_P050-HRP Conjugated

ARP34965_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Cholinergic receptor, nicotinic, alpha 4 (neuronal)
Protein Name:
Neuronal acetylcholine receptor subunit alpha-4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1772 from Santa Cruz Biotechnology.
Description of Target:
CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHRNA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHRNA4.
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA4
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CHRNA4 (ARP34965_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CHRNA4 (ARP34965_P050) antibody is Catalog # AAP34965 (Previous Catalog # AAPP06188)
Printable datasheet for anti-CHRNA4 (ARP34965_P050) antibody
Target Reference:
Fedi,M., (2008) J. Clin. Endocrinol. Metab. 93 (2), 634-637

Ishizuka, T., Ozawa, A., Goshima, H. & Watanabe, Y. Involvement of nicotinic acetylcholine receptor in the proliferation of mouse induced pluripotent stem cells. Life Sci. 90, 637-48 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22483693

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...