Size:100 ul
$319.00
In Stock
SKU
AVARP13084_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP13084_P050-FITC Conjugated

AVARP13084_P050-HRP Conjugated

AVARP13084_P050-Biotin Conjugated

CHRNA1 Antibody - C-terminal region (AVARP13084_P050)

Catalog#: AVARP13084_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityDog, Guinea Pig, Human, Mouse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-136130 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CHRNA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 80%; Pig: 100%; Rabbit: 93%
Complete computational species homology dataAnti-CHRNA1 (AVARP13084_P050)
Peptide SequenceSynthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CHRNA1 (AVARP13084_P050) antibody is Catalog # AAP30746 (Previous Catalog # AAPP01407)
Datasheets/ManualsPrintable datasheet for anti-CHRNA1 (AVARP13084_P050) antibody
Subunitalpha
Target ReferenceWebster,R., et al., (2004) Neurology 62 (7), 1090-1096
Gene SymbolCHRNA1
Official Gene Full NameCholinergic receptor, nicotinic, alpha 1 (muscle)
Alias SymbolsACHRA, ACHRD, CHRNA, CMS2A, FCCMS, SCCMS
NCBI Gene Id1134
Protein NameAcetylcholine receptor subunit alpha
Description of TargetCHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.
Swissprot IdP02708-2
Protein Accession #NP_000070
Nucleotide Accession #NM_000079
Protein Size (# AA)457
Molecular Weight52kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CHRNA1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CHRNA1.
Protein InteractionsITGA7; CHRND; CHRNG; CHRNE;
Write Your Own Review
You're reviewing:CHRNA1 Antibody - C-terminal region (AVARP13084_P050)
Your Rating
Aviva Tips and Tricks
Free Microscope
Assay Development
Aviva Validation Data