Search Antibody, Protein, and ELISA Kit Solutions

CHRNA1 Antibody - C-terminal region (AVARP13084_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP13084_P050-FITC Conjugated

AVARP13084_P050-HRP Conjugated

AVARP13084_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Pig, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CHRNA1
Official Gene Full Name:
Cholinergic receptor, nicotinic, alpha 1 (muscle)
NCBI Gene Id:
1134
Protein Name:
Acetylcholine receptor subunit alpha
Swissprot Id:
P02708-2
Protein Accession #:
NP_000070
Nucleotide Accession #:
NM_000079
Alias Symbols:
ACHRA, ACHRD, CHRNA, CMS2A, FCCMS, SCCMS
Replacement Item:
This antibody may replace item sc-136130 from Santa Cruz Biotechnology.
Description of Target:
CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.
Protein Size (# AA):
457
Molecular Weight:
52kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHRNA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHRNA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CHRNA1
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 80%; Pig: 100%; Rabbit: 93%
Complete computational species homology data:
Anti-CHRNA1 (AVARP13084_P050)
Peptide Sequence:
Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ITGA7; CHRND; CHRNG; CHRNE;
Blocking Peptide:
For anti-CHRNA1 (AVARP13084_P050) antibody is Catalog # AAP30746 (Previous Catalog # AAPP01407)
Datasheets/Manuals:
Printable datasheet for anti-CHRNA1 (AVARP13084_P050) antibody
Subunit:
alpha
Target Reference:
Webster,R., et al., (2004) Neurology 62 (7), 1090-1096

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...