CHRM3 Antibody - C-terminal region : FITC (ARP76007_P050-FITC)

Catalog No: ARP76007_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACM3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHRM3 (ARP76007_P050-FITC) antibody is Catalog # AAP76007
• Reference: N/A

Target Info

• Gene Symbol: CHRM3
• Gene Full Name: cholinergic receptor muscarinic 3
• Alias Symbols: HM3, PBS, EGBRS
• NCBI Gene Id: 1131
• Protein Name: muscarinic acetylcholine receptor M3
• Description of Target: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
• Uniprot ID: P20309
• Protein Accession #: XP_006711795
• Protein Size (# AA): 590
• Molecular Weight: 64kDa