CHRM2 Antibody - N-terminal region (ARP81294_P050)

Catalog No: ARP81294_P050

Host: Rabbit
Target Name: CHRM2
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRM2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHRM2 (ARP81294_P050) antibody is Catalog # AAP81294

Target Info

• Gene Symbol: CHRM2
• Gene Full Name: cholinergic receptor, muscarinic 2
• Alias Symbols: HM2
• NCBI Gene Id: 1129
• Protein Name: muscarinic acetylcholine receptor M2
• Description of Target: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene.
• Uniprot ID: P08172
• Protein Accession #: NP_000730.1
• Nucleotide Accession #: NM_000739.2
• Protein Size (# AA): 466
• Molecular Weight: 51 kDa