Catalog No: OPCA322078
Price: $0.00
SKU
OPCA322078
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ CHP1 Recombinant Protein (Human) (OPCA322078)
Datasheets/Manuals | Printable datasheet for OPCA322078 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | GSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 2-195 |
Gene Full Name | calcineurin like EF-hand protein 1 |
---|---|
Alias Symbols | CHP, p22, p24, Sid470p, SLC9A1BP |
NCBI Gene Id | 11261 |
Protein Name | calcineurin B homologous protein 1 |
Description of Target | This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein s |
Uniprot ID | Q99653 |
Protein Accession # | NP_009167.1 |
Nucleotide Accession # | NM_007236.4 |
Protein Size (# AA) | 194 |
Write Your Own Review