Search Antibody, Protein, and ELISA Kit Solutions

CHP Antibody - N-terminal region (ARP52307_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52307_P050-FITC Conjugated

ARP52307_P050-HRP Conjugated

ARP52307_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Calcium binding protein P22
NCBI Gene Id:
Protein Name:
Calcineurin B homologous protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHP.
The immunogen is a synthetic peptide directed towards the N terminal region of human CHP
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CHP (ARP52307_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CHP1 (ARP52307_P050) antibody is Catalog # AAP52307 (Previous Catalog # AAPP43725)
Printable datasheet for anti-CHP1 (ARP52307_P050) antibody
Sample Type Confirmation:

CHP1 is supported by BioGPS gene expression data to be expressed in 721_B

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...