Chmp5 Antibody - C-terminal region (ARP65870_P050)

Catalog No: ARP65870_P050

Host: Rabbit
Target Name: Chmp5
Sample Type: Mouse Small Intestine lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
• Peptide Sequence: Synthetic peptide located within the following region: LDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Chmp5 (ARP65870_P050) antibody is Catalog # AAP65870

Target Info

• Gene Symbol: Chmp5
• Gene Full Name: charged multivesicular body protein 5
• Alias Symbols: AW545668, 2210412K09Rik
• NCBI Gene Id: 76959
• Protein Name: Charged multivesicular body protein 5
• Description of Target: Chmp5 is a probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.
• Uniprot ID: Q9D7S9
• Protein Accession #: NP_084090
• Nucleotide Accession #: NM_029814
• Protein Size (# AA): 219
• Molecular Weight: 24kDa
• Protein Interactions: Ndn;