Search Antibody, Protein, and ELISA Kit Solutions

CHMP4B antibody - middle region (ARP53340_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53340_P050-FITC Conjugated

ARP53340_P050-HRP Conjugated

ARP53340_P050-Biotin Conjugated

Gene Symbol:
CHMP4B
NCBI Gene Id:
128866
Official Gene Full Name:
Charged multivesicular body protein 4B
Protein Name:
Charged multivesicular body protein 4b
Swissprot Id:
Q9H444
Protein Accession #:
NP_789782
Nucleotide Accession #:
NM_176812
Alias Symbols:
C20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2
Replacement Item:
This antibody may replace item sc-134946 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.
Protein Size (# AA):
224
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHMP4B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHMP4B.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CHMP4B (ARP53340_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; TP53; CHMP6; UBE2I; PDCD6IP; VCAM1; ITGA4; RPLP0P6; MVP; ATP6V1B1; BROX; CHMP4B; CHMP4C; CHMP1B; CHMP3; CHMP5; CHMP4A; HIPK2; VPS4A; STAMBP; PIAS2; EXOSC9; HCVgp1; NOLC1; PTPN23;
Blocking Peptide:
For anti-CHMP4B (ARP53340_P050) antibody is Catalog # AAP53340 (Previous Catalog # AAPP42240)
Datasheets/Manuals:
Printable datasheet for anti-CHMP4B (ARP53340_P050) antibody
Publications:

Bodon, G. et al. Charged multivesicular body protein 2B (CHMP2B) of the endosomal sorting complex required for transport-III (ESCRT-III) polymerizes into helical structures deforming the plasma membrane. J. Biol. Chem. 286, 40276-86 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21926173

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...