Size:100 ul
$319.00
In Stock
SKU
ARP53340_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53340_P050-FITC Conjugated

ARP53340_P050-HRP Conjugated

ARP53340_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-134946 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CHMP4B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-CHMP4B (ARP53340_P050)
Peptide SequenceSynthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CHMP4B (ARP53340_P050) antibody is Catalog # AAP53340 (Previous Catalog # AAPP42240)
Datasheets/ManualsPrintable datasheet for anti-CHMP4B (ARP53340_P050) antibody
Publications

Bodon, G. et al. Charged multivesicular body protein 2B (CHMP2B) of the endosomal sorting complex required for transport-III (ESCRT-III) polymerizes into helical structures deforming the plasma membrane. J. Biol. Chem. 286, 40276-86 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21926173

Gene SymbolCHMP4B
Official Gene Full NameCharged multivesicular body protein 4B
Alias SymbolsC20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2
NCBI Gene Id128866
Protein NameCharged multivesicular body protein 4b
Description of TargetThis gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.
Swissprot IdQ9H444
Protein Accession #NP_789782
Nucleotide Accession #NM_176812
Protein Size (# AA)224
Molecular Weight25kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CHMP4B.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CHMP4B.
Protein InteractionsUBC; TP53; CHMP6; UBE2I; PDCD6IP; VCAM1; ITGA4; RPLP0P6; MVP; ATP6V1B1; BROX; CHMP4B; CHMP4C; CHMP1B; CHMP3; CHMP5; CHMP4A; HIPK2; VPS4A; STAMBP; PIAS2; EXOSC9; HCVgp1; NOLC1; PTPN23;
Write Your Own Review
You're reviewing:CHMP4B Antibody - middle region (ARP53340_P050)
Your Rating
Aviva Blast Tool
Free Microscope
Aviva Validation Data
Aviva Travel Grant