Loading...
Catalog No: ARP53340_P050
Price: $0.00
SKU
ARP53340_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CHMP4B (ARP53340_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CHMP4B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP
Concentration0.5 mg/ml
Blocking PeptideFor anti-CHMP4B (ARP53340_P050) antibody is Catalog # AAP53340 (Previous Catalog # AAPP42240)
Publications

Bodon, G. et al. Charged multivesicular body protein 2B (CHMP2B) of the endosomal sorting complex required for transport-III (ESCRT-III) polymerizes into helical structures deforming the plasma membrane. J. Biol. Chem. 286, 40276-86 (2011). 21926173

Gene SymbolCHMP4B
Gene Full NameCharged multivesicular body protein 4B
Alias SymbolsSNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT31, Vps32-2, C20orf178, dJ553F4.4
NCBI Gene Id128866
Protein NameCharged multivesicular body protein 4b
Description of TargetThis gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.
Uniprot IDQ9H444
Protein Accession #NP_789782
Nucleotide Accession #NM_176812
Protein Size (# AA)224
Molecular Weight25kDa
Protein InteractionsUBC; TP53; CHMP6; UBE2I; PDCD6IP; VCAM1; ITGA4; RPLP0P6; MVP; ATP6V1B1; BROX; CHMP4B; CHMP4C; CHMP1B; CHMP3; CHMP5; CHMP4A; HIPK2; VPS4A; STAMBP; PIAS2; EXOSC9; HCVgp1; NOLC1; PTPN23;
  1. What is the species homology for "CHMP4B Antibody - middle region (ARP53340_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CHMP4B Antibody - middle region (ARP53340_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHMP4B Antibody - middle region (ARP53340_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHMP4B Antibody - middle region (ARP53340_P050)"?

    This target may also be called "SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT31, Vps32-2, C20orf178, dJ553F4.4" in publications.

  5. What is the shipping cost for "CHMP4B Antibody - middle region (ARP53340_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHMP4B Antibody - middle region (ARP53340_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHMP4B Antibody - middle region (ARP53340_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHMP4B Antibody - middle region (ARP53340_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHMP4B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHMP4B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHMP4B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHMP4B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHMP4B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHMP4B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHMP4B Antibody - middle region (ARP53340_P050)
Your Rating
We found other products you might like!