Search Antibody, Protein, and ELISA Kit Solutions

CHML Antibody (ARP30667_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30667_P050-FITC Conjugated

ARP30667_P050-HRP Conjugated

ARP30667_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CHML
Official Gene Full Name:
choroideremia-like (Rab escort protein 2)
NCBI Gene Id:
1122
Protein Name:
Rab proteins geranylgeranyltransferase component A 2
Swissprot Id:
P26374
Protein Accession #:
NP_001812
Nucleotide Accession #:
NM_001821
Alias Symbols:
REP2,
Description of Target:
The product of the CHML gene supports geranylgeranylation of most Rab proteins and may substitute for REP-1 in tissues other than retina. CHML is localized close to the gene for Usher syndrome type II.
Protein Size (# AA):
656
Molecular Weight:
74 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHML.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHML.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence NVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKS
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CHML (ARP30667_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RAB6A; RAB5A; RAB1A; RAB3A; RABGGTB;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-CHML (ARP30667_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...