CHIC2 Antibody - N-terminal region (ARP46856_P050)

Catalog No: ARP46856_P050

WB Suggested Anti-CHIC2 Antibody Titration: 0.25ug/ml
Positive Control: HepG2 cell lysate

Human Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 15%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHIC2 (ARP46856_P050) antibody is Catalog # AAP46856 (Previous Catalog # AAPP27652)
• Reference: Pardanani,A., (2003) Blood 102 (9), 3093-3096

Target Info

• Gene Symbol: CHIC2
• Gene Full Name: Cysteine-rich hydrophobic domain 2
• Alias Symbols: BTL
• NCBI Gene Id: 26511
• Protein Name: Cysteine-rich hydrophobic domain 2 protein
• Description of Target: CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia.
• Uniprot ID: Q9UKJ5
• Protein Accession #: NP_036242
• Nucleotide Accession #: NM_012110
• Protein Size (# AA): 165
• Molecular Weight: 19kDa
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-1; KRTAP10-9; KRTAP10-7; SPERT; KRT40; KRTAP4-2; CEP44; GMCL1; PNMA1; UBC; TCF4; MEOX2; KRTAP5-9; CDR2; PLEKHF2; TUBGCP4; ITSN2; ELAVL1; KRTAP4-12; CATSPER1; OTX1; MDFI; TOP3B; U2AF2; HOXA1;