Search Antibody, Protein, and ELISA Kit Solutions

CHIA antibody - N-terminal region (ARP42601_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42601_P050-FITC Conjugated

ARP42601_P050-HRP Conjugated

ARP42601_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Chitinase, acidic
Protein Name:
Acidic mammalian chitinase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
2200003E03Rik, AMCase, CHIT2, DKFZp313J1722, RP5-1125M8.1, TSA1902, AMCASE
Description of Target:
CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHIA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHIA.
The immunogen is a synthetic peptide directed towards the N terminal region of human CHIA
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CHIA (ARP42601_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CHIA (ARP42601_P050) antibody is Catalog # AAP42601 (Previous Catalog # AAPP24837)
Printable datasheet for anti-CHIA (ARP42601_P050) antibody
Target Reference:
Chou,Y.T., (2006) Biochemistry 45 (14), 4444-4454

Fukushima, T., Nashida, T., Haga-Tsujimura, M. & Mataga, I. Chitinase expression in parotid glands of non-obese diabetic mice. Oral Dis. 18, 506-12 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish 22309644

Strobel, S., Roswag, A., Becker, N. I., Trenczek, T. E. & Encarnação, J. A. Insectivorous bats digest chitin in the stomach using acidic mammalian chitinase. PLoS One 8, e72770 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish 24019876

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...