Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP42601_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42601_P050-FITC Conjugated

ARP42601_P050-HRP Conjugated

ARP42601_P050-Biotin Conjugated

CHIA Antibody - N-terminal region (ARP42601_P050)

Catalog#: ARP42601_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHIA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-CHIA (ARP42601_P050)
Peptide Sequence Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CHIA (ARP42601_P050) antibody is Catalog # AAP42601 (Previous Catalog # AAPP24837)
Datasheets/Manuals Printable datasheet for anti-CHIA (ARP42601_P050) antibody
Target Reference Chou,Y.T., (2006) Biochemistry 45 (14), 4444-4454
Publications

Fukushima, T., Nashida, T., Haga-Tsujimura, M. & Mataga, I. Chitinase expression in parotid glands of non-obese diabetic mice. Oral Dis. 18, 506-12 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish 22309644

Strobel, S., Roswag, A., Becker, N. I., Trenczek, T. E. & Encarnação, J. A. Insectivorous bats digest chitin in the stomach using acidic mammalian chitinase. PLoS One 8, e72770 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish 24019876

Gene Symbol CHIA
Official Gene Full Name Chitinase, acidic
Alias Symbols 2200003E03Rik, AMCase, CHIT2, DKFZp313J1722, RP5-1125M8.1, TSA1902, AMCASE
NCBI Gene Id 27159
Protein Name Acidic mammalian chitinase
Description of Target CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Swissprot Id Q9BZP6
Protein Accession # NP_068569
Nucleotide Accession # NM_021797
Protein Size (# AA) 368
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHIA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHIA.
  1. What is the species homology for "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish".

  2. How long will it take to receive "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHIA Antibody - N-terminal region (ARP42601_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    This target may also be called "2200003E03Rik, AMCase, CHIT2, DKFZp313J1722, RP5-1125M8.1, TSA1902, AMCASE" in publications.

  5. What is the shipping cost for "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHIA Antibody - N-terminal region (ARP42601_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CHIA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHIA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHIA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHIA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHIA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHIA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHIA Antibody - N-terminal region (ARP42601_P050)
Your Rating
We found other products you might like!