Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP42601_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42601_P050-FITC Conjugated

ARP42601_P050-HRP Conjugated

ARP42601_P050-Biotin Conjugated

CHIA Antibody - N-terminal region (ARP42601_P050)

Catalog#: ARP42601_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHIA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-CHIA (ARP42601_P050)
Peptide Sequence Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CHIA (ARP42601_P050) antibody is Catalog # AAP42601 (Previous Catalog # AAPP24837)
Datasheets/Manuals Printable datasheet for anti-CHIA (ARP42601_P050) antibody
Target Reference Chou,Y.T., (2006) Biochemistry 45 (14), 4444-4454
Publications

Fukushima, T., Nashida, T., Haga-Tsujimura, M. & Mataga, I. Chitinase expression in parotid glands of non-obese diabetic mice. Oral Dis. 18, 506-12 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish 22309644

Strobel, S., Roswag, A., Becker, N. I., Trenczek, T. E. & Encarnação, J. A. Insectivorous bats digest chitin in the stomach using acidic mammalian chitinase. PLoS One 8, e72770 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish 24019876

Gene Symbol CHIA
Official Gene Full Name Chitinase, acidic
Alias Symbols 2200003E03Rik, AMCase, CHIT2, DKFZp313J1722, RP5-1125M8.1, TSA1902, AMCASE
NCBI Gene Id 27159
Protein Name Acidic mammalian chitinase
Description of Target CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
Swissprot Id Q9BZP6
Protein Accession # NP_068569
Nucleotide Accession # NM_021797
Protein Size (# AA) 368
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHIA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHIA.
Write Your Own Review
You're reviewing:CHIA Antibody - N-terminal region (ARP42601_P050)
Your Rating