Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP57039_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57039_P050-FITC Conjugated

ARP57039_P050-HRP Conjugated

ARP57039_P050-Biotin Conjugated

CHCHD3 Antibody - N-terminal region (ARP57039_P050)

Catalog#: ARP57039_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-142315 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Complete computational species homology data Anti-CHCHD3 (ARP57039_P050)
Peptide Sequence Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CHCHD3 (ARP57039_P050) antibody is Catalog # AAP57039 (Previous Catalog # AAPP40532)
Datasheets/Manuals Printable datasheet for anti-CHCHD3 (ARP57039_P050) antibody
Target Reference 0
Publications

Darshi, M., Trinh, K. N., Murphy, A. N. & Taylor, S. S. Targeting and import mechanism of coiled-coil helix coiled-coil helix domain-containing protein 3 (ChChd3) into the mitochondrial intermembrane space. J. Biol. Chem. 287, 39480-91 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23019327

Ott, C. et al. Sam50 functions in mitochondrial intermembrane space bridging and biogenesis of respiratory complexes. Mol. Cell. Biol. 32, 1173-88 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 22252321

Gene Symbol CHCHD3
Official Gene Full Name Coiled-coil-helix-coiled-coil-helix domain containing 3
Alias Symbols FLJ20420, MINOS3, PPP1R22
NCBI Gene Id 54927
Protein Name Coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial
Description of Target The function of this protein remains unknown.
Swissprot Id Q9NX63
Protein Accession # NP_060282
Nucleotide Accession # NM_017812
Protein Size (# AA) 227
Molecular Weight 26kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHCHD3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHCHD3.
Protein Interactions NOTCH2NL; SPERT; KRT40; SSX2IP; RAB3IP; LZTS2; USHBP1; CCDC33; GMCL1P1; RPGRIP1; FANCL; SAMM50; SPAG5; CALCOCO2; PDE4DIP; BLZF1; TRAF1; TRIM27; GOLGA2; UBC; GPRASP2; MDM2; SUZ12; RNF2; EZH2; PARK2; HDAC8; NPM1; PAN2; PPP1CA; MYC; FMNL1; MDC1; ECT2; SNRPD3
Write Your Own Review
You're reviewing:CHCHD3 Antibody - N-terminal region (ARP57039_P050)
Your Rating