Search Antibody, Protein, and ELISA Kit Solutions

CHCHD3 Antibody - N-terminal region (ARP57039_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP57039_P050-FITC Conjugated

ARP57039_P050-HRP Conjugated

ARP57039_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-142315 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD3
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Complete computational species homology data:
Anti-CHCHD3 (ARP57039_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CHCHD3 (ARP57039_P050) antibody is Catalog # AAP57039 (Previous Catalog # AAPP40532)
Printable datasheet for anti-CHCHD3 (ARP57039_P050) antibody
Target Reference:

Darshi, M., Trinh, K. N., Murphy, A. N. & Taylor, S. S. Targeting and import mechanism of coiled-coil helix coiled-coil helix domain-containing protein 3 (ChChd3) into the mitochondrial intermembrane space. J. Biol. Chem. 287, 39480-91 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23019327

Ott, C. et al. Sam50 functions in mitochondrial intermembrane space bridging and biogenesis of respiratory complexes. Mol. Cell. Biol. 32, 1173-88 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 22252321

Gene Symbol:
Official Gene Full Name:
Coiled-coil-helix-coiled-coil-helix domain containing 3
Alias Symbols:
FLJ20420, MINOS3, PPP1R22
NCBI Gene Id:
Protein Name:
Coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial
Description of Target:
The function of this protein remains unknown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHCHD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHCHD3.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...