Search Antibody, Protein, and ELISA Kit Solutions

CHCHD3 Antibody - N-terminal region (ARP57039_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57039_P050-FITC Conjugated

ARP57039_P050-HRP Conjugated

ARP57039_P050-Biotin Conjugated

Gene Symbol:
CHCHD3
Official Gene Full Name:
Coiled-coil-helix-coiled-coil-helix domain containing 3
NCBI Gene Id:
54927
Protein Name:
Coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial
Swissprot Id:
Q9NX63
Protein Accession #:
NP_060282
Nucleotide Accession #:
NM_017812
Alias Symbols:
FLJ20420, MINOS3, PPP1R22
Replacement Item:
This antibody may replace item sc-142315 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
227
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHCHD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHCHD3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Complete computational species homology data:
Anti-CHCHD3 (ARP57039_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NOTCH2NL; SPERT; KRT40; SSX2IP; RAB3IP; LZTS2; USHBP1; CCDC33; GMCL1P1; RPGRIP1; FANCL; SAMM50; SPAG5; CALCOCO2; PDE4DIP; BLZF1; TRAF1; TRIM27; GOLGA2; UBC; GPRASP2; MDM2; SUZ12; RNF2; EZH2; PARK2; HDAC8; NPM1; PAN2; PPP1CA; MYC; FMNL1; MDC1; ECT2; SNRPD3
Blocking Peptide:
For anti-CHCHD3 (ARP57039_P050) antibody is Catalog # AAP57039 (Previous Catalog # AAPP40532)
Datasheets/Manuals:
Printable datasheet for anti-CHCHD3 (ARP57039_P050) antibody
Target Reference:
0
Publications:

Darshi, M., Trinh, K. N., Murphy, A. N. & Taylor, S. S. Targeting and import mechanism of coiled-coil helix coiled-coil helix domain-containing protein 3 (ChChd3) into the mitochondrial intermembrane space. J. Biol. Chem. 287, 39480-91 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23019327

Ott, C. et al. Sam50 functions in mitochondrial intermembrane space bridging and biogenesis of respiratory complexes. Mol. Cell. Biol. 32, 1173-88 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 22252321

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...