CHAT Antibody - C-terminal region (ARP30665_P050)

Catalog No: ARP30665_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-CHAT Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Horse: 100%; Human: 100%; Pig: 91%
• Peptide Sequence: Synthetic peptide located within the following region: SSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHAT (ARP30665_P050) antibody is Catalog # AAP30665

Target Info

• Gene Symbol: CHAT
• Gene Full Name: Choline O-acetyltransferase
• Alias Symbols: CMS6, CMS1A, CMS1A2, CHOACTASE
• NCBI Gene Id: 1103
• Protein Name: CHAT protein EMBL AAI30618.1
• Description of Target: CHAT is an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This protein is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
• Uniprot ID: A2BDF5
• Protein Accession #: NP_066264
• Nucleotide Accession #: NM_020984
• Protein Size (# AA): 630
• Molecular Weight: 70kDa
• Protein Interactions: NEDD9; CAMK2A; CAMK2G; PRKCZ; PRKCG; PRKCD; PRKCE; PRKCB; PRKCA;