CHAF1B Antibody - N-terminal region (ARP45826_P050)

Catalog No: ARP45826_P050

WB Suggested Anti-CHAF1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

CHAF1B antibody - N-terminal region (ARP45826_P050) validated by WB using Mouse brains at 1:1000.

Host: Rabbit
Target Name: CHAF1B
Sample Type: HepG2
Antibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in HepG2

Host: Rabbit
Target Name: CHAF1B
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in Jurkat

Host: Rabbit
Target Name: CHAF1B
Sample Type: 293T
Antibody Dilution: 1.0ug/mlCHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T

Host: Rabbit
Target Name: CHAF1B
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHAF1B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHAF1B (ARP45826_P050) antibody is Catalog # AAP45826 (Previous Catalog # AAPP26763)
• Sample Type Confirmation:

  CHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2, Jurkat

• Subunit: B
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

  The GABAAα5-selective Modulator, RO4938581, Rescues Protein Anomalies in the Ts65Dn Mouse Model of Down Syndrome. Neuroscience. 372, 192-212 (2018) 29292072

Target Info

• Gene Symbol: CHAF1B
• Gene Full Name: Chromatin assembly factor 1, subunit B (p60)
• Alias Symbols: CAF1, MPP7, CAF-1, CAF1A, CAF1P60, CAF-IP60, MPHOSPH7
• NCBI Gene Id: 8208
• Protein Name: Chromatin assembly factor 1 subunit B
• Description of Target: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q13112
• Protein Accession #: NP_005432
• Nucleotide Accession #: NM_005441
• Protein Size (# AA): 559
• Molecular Weight: 61kDa
• Protein Interactions: UBC; SOX2; CNOT6L; env; CBX6; CBX5; HIST1H3B; HIST1H3A; CHAF1A; PCNA; APP; HIST2H3C; HIST1H4F; HIST1H3E; HIST3H3; SUMO2; BANF1; ASF1B; ASF1A; SETDB1; RBBP4; CDK2; CDK1;