Search Antibody, Protein, and ELISA Kit Solutions

CHAF1B Antibody - N-terminal region (ARP45826_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45826_P050-FITC Conjugated

ARP45826_P050-HRP Conjugated

ARP45826_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Chromatin assembly factor 1, subunit B (p60)
NCBI Gene Id:
Protein Name:
Chromatin assembly factor 1 subunit B
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10982 from Santa Cruz Biotechnology.
Description of Target:
Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHAF1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHAF1B.
The immunogen is a synthetic peptide directed towards the N terminal region of human CHAF1B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-CHAF1B (ARP45826_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CHAF1B (ARP45826_P050) antibody is Catalog # AAP45826 (Previous Catalog # AAPP26763)
Printable datasheet for anti-CHAF1B (ARP45826_P050) antibody
Sample Type Confirmation:

CHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2, Jurkat

Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...