Protein on Demand™ CHAD Recombinant Protein (Human) (OPCA16444)

Datasheets/Manuals	Printable datasheet for OPCA16444

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	23-359

Gene Full Name	chondroadherin
Alias Symbols	SLRR4A
NCBI Gene Id	1101
Protein Name	chondroadherin
Description of Target	Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.
Uniprot ID	O15335
Protein Accession #	NP_001258.2
Nucleotide Accession #	NM_001267.2
Protein Size (# AA)	337