Search Antibody, Protein, and ELISA Kit Solutions

CFP Antibody - N-terminal region (ARP56381_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56381_P050-FITC Conjugated

ARP56381_P050-HRP Conjugated

ARP56381_P050-Biotin Conjugated

Gene Symbol:
CFP
Official Gene Full Name:
Complement factor properdin
NCBI Gene Id:
5199
Protein Name:
Properdin
Swissprot Id:
P27918
Protein Accession #:
NP_002612
Nucleotide Accession #:
NM_002621
Alias Symbols:
BFD, PFC, PFD, PROPERDIN
Replacement Item:
This antibody may replace item sc-365664 from Santa Cruz Biotechnology.
Description of Target:
CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac
Protein Size (# AA):
469
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CFP
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CFP (ARP56381_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ELAVL1; CFB; C3; MTOR;
Blocking Peptide:
For anti-CFP (ARP56381_P050) antibody is Catalog # AAP56381 (Previous Catalog # AAPP38442)
Datasheets/Manuals:
Printable datasheet for anti-CFP (ARP56381_P050) antibody
Target Reference:
Bathum,L., (2006) Mol. Immunol. 43 (5), 473-479

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...