CFHR3 Antibody - middle region (ARP52394_P050)

Catalog No: ARP52394_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: FHR3
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FHR3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 79%; Human: 100%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: FISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICINS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CFHR3 (ARP52394_P050) antibody is Catalog # AAP52394

Target Info

• Gene Symbol: CFHR3
• Gene Full Name: complement factor H related 3
• Alias Symbols: FHR3, HLF4, CFHL3, FHR-3, DOWN16
• NCBI Gene Id: 10878
• Protein Name: complement factor H-related protein 3
• Description of Target: The protein encoded by this gene is a secreted protein, which belongs to the complement factor H-related protein family. It binds to heparin, and may be involved in complement regulation. Mutations in this gene are associated with decreased risk of age-related macular degeneration, and with an increased risk of atypical hemolytic-uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q02985
• Protein Accession #: NP_066303
• Protein Size (# AA): 330
• Molecular Weight: 36kDa
• Protein Interactions: PRDX4; C3;