CFD Recombinant Protein (Rat) (OPCA05432)

Catalog No: OPCA05432

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Rattus norvegicus (Rat)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
• Protein Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 26-263 aa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Info

• Reference: Purification and partial characterization of rat factor D.Baker B.C., Campbell C.J., Grinham C.J., Turcatti G.Biochem. J. 279:775-779(1991)
• Gene Symbol: Cfd
• Gene Full Name: complement factor D
• Alias Symbols: adipsin;Adn;C3 convertase activator;complement factor D;D component of complement (adipsin);Df;endogenous vascular elastase;EVE;properdin factor D.
• NCBI Gene Id: 54249
• Protein Name: Complement factor D
• Description of Target: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
• Uniprot ID: P32038
• Protein Accession #: NP_001071110
• Nucleotide Accession #: NM_001077642
• Protein Size (# AA): Recombinant
• Molecular Weight: 29.8 kDa