Search Antibody, Protein, and ELISA Kit Solutions

CFAP53 Antibody - N-terminal region : Biotin (ARP55454_P050-Biotin)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55454_P050 Unconjugated

ARP55454_P050-FITC Conjugated

ARP55454_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-142054 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
Complete computational species homology data:
Anti-CCDC11 (ARP55454_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-CFAP53 (ARP55454_P050-Biotin) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346)
Datasheets/Manuals:
Printable datasheet for anti-CFAP53 (ARP55454_P050-Biotin) antibody
Target Reference:
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Publications:

Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). WB, ICC/IF, Human, Bovine, Pig, Horse, Dog, Guinea pig 22577226

Gene Symbol:
CFAP53
Official Gene Full Name:
cilia and flagella associated protein 53
Alias Symbols:
HTX6, CCDC11
NCBI Gene Id:
220136
Protein Name:
cilia- and flagella-associated protein 53
Description of Target:
This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
Swissprot Id:
Q96M91
Protein Accession #:
NP_659457
Nucleotide Accession #:
NM_145020
Protein Size (# AA):
514
Molecular Weight:
62kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP53.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP53.
Protein Interactions:
TNIP1; CEP70; CBY1; HMG20A; PNMA1; TRIM23; APP; CCDC85B; TEX11;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...