CFAP53 Antibody - N-terminal region (ARP55454_P050)

Catalog#: ARP55454_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human 293T

Size:	100 ul
Price:	$319.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Go To Shopping Cart

Conjugation Options

ARP55454_P050-FITC Conjugated

ARP55454_P050-HRP Conjugated

ARP55454_P050-Biotin Conjugated

Gene Symbol:: CFAP53
NCBI Gene Id:: 220136
Official Gene Full Name:: cilia and flagella associated protein 53
Protein Name:: cilia- and flagella-associated protein 53
Swissprot Id:: Q96M91
Protein Accession #:: NP_659457
Nucleotide Accession #:: NM_145020
Alias Symbols:: HTX6, CCDC11
Replacement Item:: This antibody may replace item sc-142054 from Santa Cruz Biotechnology.
Description of Target:: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
Protein Size (# AA):: 514
Molecular Weight:: 62kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express CFAP53.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express CFAP53.
Immunogen:: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
Tested Species Reactivity:: Human
Predicted Homology Based on Immunogen Sequence:: Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
Complete computational species homology data:: Anti-CCDC11 (ARP55454_P050)
Peptide Sequence:: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: TNIP1; CEP70; CBY1; HMG20A; PNMA1; TRIM23; APP; CCDC85B; TEX11;
Blocking Peptide:: For anti-CFAP53 (ARP55454_P050) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346)
Datasheets/Manuals:: Printable datasheet for anti-CFAP53 (ARP55454_P050) antibody

Target Reference:: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Publications:: Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Pig 22577226