CFAP53 Antibody - N-terminal region (ARP55454_P050)

Size:100 ul

Human 293T

Human Lung, Human Brain

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-142054 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
• Complete computational species homology data: Anti-CCDC11 (ARP55454_P050)
• Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-CFAP53 (ARP55454_P050) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346)
• Datasheets/Manuals: Printable datasheet for anti-CFAP53 (ARP55454_P050) antibody
• Target Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Publications:

  Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Pig 22577226

Target Info

• Gene Symbol: CFAP53
• Official Gene Full Name: cilia and flagella associated protein 53
• Alias Symbols: HTX6, CCDC11
• NCBI Gene Id: 220136
• Protein Name: cilia- and flagella-associated protein 53
• Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
• Swissprot Id: Q96M91
• Protein Accession #: NP_659457
• Nucleotide Accession #: NM_145020
• Protein Size (# AA): 514
• Molecular Weight: 62kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express CFAP53.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CFAP53.
• Protein Interactions: TNIP1; CEP70; CBY1; HMG20A; PNMA1; TRIM23; APP; CCDC85B; TEX11;