CFAP53 Antibody - N-terminal region (ARP55454_P050)

Catalog No: ARP55454_P050

WB Suggested Anti-CCDC11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Host: Rabbit
Target: CCDC11
Positive control (+): Human Lung (LU)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml

Product Info

• Publications:

  Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). 22577226

  More...

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
• Peptide Sequence: Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CFAP53 (ARP55454_P050) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346)

Target Info

• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Gene Symbol: CFAP53
• Gene Full Name: cilia and flagella associated protein 53
• Alias Symbols: HTX6, CCDC11
• NCBI Gene Id: 220136
• Protein Name: cilia- and flagella-associated protein 53
• Description of Target: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
• Uniprot ID: Q96M91
• Protein Accession #: NP_659457
• Nucleotide Accession #: NM_145020
• Protein Size (# AA): 514
• Molecular Weight: 62kDa
• Protein Interactions: TNIP1; CEP70; CBY1; HMG20A; PNMA1; TRIM23; APP; CCDC85B; TEX11;