- Gene Symbol:
- CFAP53
- NCBI Gene Id:
- 220136
- Official Gene Full Name:
- cilia and flagella associated protein 53
- Protein Name:
- cilia- and flagella-associated protein 53
- Swissprot Id:
- Q96M91
- Protein Accession #:
- NP_659457
- Nucleotide Accession #:
- NM_145020
- Alias Symbols:
- HTX6, CCDC11
- Replacement Item:
- This antibody may replace item sc-142054 from Santa Cruz Biotechnology.
- Description of Target:
- This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
- Protein Size (# AA):
- 514
- Molecular Weight:
- 62kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CFAP53.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CFAP53.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
- Complete computational species homology data:
- Anti-CCDC11 (ARP55454_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- TNIP1; CEP70; CBY1; HMG20A; PNMA1; TRIM23; APP; CCDC85B; TEX11;
- Blocking Peptide:
- For anti-CFAP53 (ARP55454_P050) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346)
- Datasheets/Manuals:
- Printable datasheet for anti-CFAP53 (ARP55454_P050) antibody
- Target Reference:
- Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
- Publications:
Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Pig 22577226
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
