Search Antibody, Protein, and ELISA Kit Solutions

CFAP53 Antibody - N-terminal region (ARP55454_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP55454_P050-FITC Conjugated

ARP55454_P050-HRP Conjugated

ARP55454_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
cilia and flagella associated protein 53
NCBI Gene Id:
Protein Name:
cilia- and flagella-associated protein 53
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-142054 from Santa Cruz Biotechnology.
Description of Target:
This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP53.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP53.
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
Complete computational species homology data:
Anti-CCDC11 (ARP55454_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CFAP53 (ARP55454_P050) antibody is Catalog # AAP55454 (Previous Catalog # AAPP33346)
Printable datasheet for anti-CFAP53 (ARP55454_P050) antibody
Target Reference:
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Perles, Z. et al. A human laterality disorder associated with recessive CCDC11 mutation. J. Med. Genet. 49, 386-90 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Pig 22577226

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 03:08
  • Overall Experience:
  • Quality:
Nasal Respiratory cells in IF

Submitted by:
Sudipto Roy
Institute of Molecular and Cell Biology (IMCB)


1. Species and tissue/cell type used: Nasal Respiratory cells

2. Fixation method: Paraformaldehyde

3. Antigen retrieval method: None.

4. Primary antibody dilution: 1:250, 1 hour RT.

5. Secondary antibody and dilution: Anti Rabbit 488, 1:250, 1 hour RT.

6. Stain/counterstain:
CFAP53 - Green
DAPI - Blue
Acetylated tubulin - Red

7. Protocol:
- Wash with PBS
- Permeabilize using Triton
- Blocking using 2%BSA overnight
- Wash with PBS
- Primary Ab staining for 1 hour
- Washing with PBS
- Secondary Ab staining for 1 hour
- Washing with PBS
- Mount with vetashield

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...