SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45819_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP45819_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-CFAP410 (ARP45819_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C21orf2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS
Concentration0.5 mg/ml
Blocking PeptideFor anti-CFAP410 (ARP45819_P050-FITC) antibody is Catalog # AAP45819 (Previous Catalog # AAPP26757)
Sample Type Confirmation

There is BioGPS gene expression data showing that C21orf2 is expressed in HEK293T

ReferenceOh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Gene SymbolCFAP410
Gene Full Namecilia and flagella associated protein 410
Alias SymbolsRDMS, SMDAX, LRRC76, YF5/A2, C21orf2
NCBI Gene Id755
Protein Nameprotein C21orf2; nuclear encoded mitochondrial protein C21orf2
Description of TargetFour alternatively spliced transcript variants encoding four different isoforms have been found for this nuclear gene. All isoforms contain leucine-rich repeats. Three of these isoforms are mitochondrial proteins and one of them lacks the target peptide, so is not located in mitochondrion. This gene is down-regulated in Down syndrome (DS) brain, which may represent mitochondrial dysfunction in DS patients.
Uniprot IDO43822
Protein Accession #NP_004919
Nucleotide Accession #NM_004928
Protein Size (# AA)256
Molecular Weight28kDa
Protein InteractionsGMCL1; ATOX1; UBC;
  1. What is the species homology for "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    This target may also be called "RDMS, SMDAX, LRRC76, YF5/A2, C21orf2" in publications.

  5. What is the shipping cost for "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CFAP410"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CFAP410"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CFAP410"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CFAP410"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CFAP410"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CFAP410"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CFAP410 Antibody - N-terminal region : FITC (ARP45819_P050-FITC)
Your Rating
We found other products you might like!