Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP45873_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP45873_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-CFAP298 (ARP45873_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CFAP298 (ARP45873_P050-FITC) antibody is Catalog # AAP45873 (Previous Catalog # AAPS17104)
Sample Type Confirmation

C21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceDenoeud,F., (2007) Genome Res. 17 (6), 746-759
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Mouse, Pig, Horse, Guinea pig, Rat, Rabbit, Bovine, Dog 23103828

Gene SymbolCFAP298
Gene Full Namecilia and flagella associated protein 298
Alias SymbolsKur, FBB18, CILD26, C21orf48, C21orf59
NCBI Gene Id56683
Protein Namecilia- and flagella-associated protein 298
Description of TargetThis gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene.
Uniprot IDP57076
Protein Accession #NP_067077
Nucleotide Accession #NM_021254
Protein Size (# AA)290
Molecular Weight33kDa
Protein InteractionsBAG3; LYN; UBC; APP; SUMO2; MAPK6;
  1. What is the species homology for "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    This target may also be called "Kur, FBB18, CILD26, C21orf48, C21orf59" in publications.

  5. What is the shipping cost for "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CFAP298"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CFAP298"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CFAP298"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CFAP298"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CFAP298"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CFAP298"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CFAP298 Antibody - N-terminal region : FITC (ARP45873_P050-FITC)
Your Rating
We found other products you might like!