CFAP298 Antibody - N-terminal region (ARP45873_P050)

Catalog#: ARP45873_P050

• Size: 100 ul

• Gene Symbol: CFAP298
• NCBI Gene Id: 56683
• Official Gene Full Name: cilia and flagella associated protein 298
• Protein Name: cilia- and flagella-associated protein 298
• Swissprot Id: P57076
• Protein Accession #: NP_067077
• Nucleotide Accession #: NM_021254
• Alias Symbols: Kur, FBB18, CILD26, C21orf48, C21orf59
• Replacement Item: This antibody may replace item sc-365454 from Santa Cruz Biotechnology.
• Description of Target: This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene.
• Protein Size (# AA): 290
• Molecular Weight: 33kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CFAP298.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: BAG3; LYN; UBC; APP; SUMO2; MAPK6;
• Blocking Peptide: For anti-CFAP298 (ARP45873_P050) antibody is Catalog # AAP45873 (Previous Catalog # AAPS17104)
• Sample Type Confirmation:

  C21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat

• Target Reference: Denoeud,F., (2007) Genome Res. 17 (6), 746-759
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: C21orf59 antibody tested with Human Jurkat Cells (ARP45873_P050)