Search Antibody, Protein, and ELISA Kit Solutions

CFAP298 Antibody - N-terminal region (ARP45873_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45873_P050-FITC Conjugated

ARP45873_P050-HRP Conjugated

ARP45873_P050-Biotin Conjugated

Gene Symbol:
CFAP298
Official Gene Full Name:
cilia and flagella associated protein 298
NCBI Gene Id:
56683
Protein Name:
cilia- and flagella-associated protein 298
Swissprot Id:
P57076
Protein Accession #:
NP_067077
Nucleotide Accession #:
NM_021254
Alias Symbols:
Kur, FBB18, CILD26, C21orf48, C21orf59
Replacement Item:
This antibody may replace item sc-365454 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene.
Protein Size (# AA):
290
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP298.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP298.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-C21orf59 (ARP45873_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3; LYN; UBC; APP; SUMO2; MAPK6;
Blocking Peptide:
For anti-CFAP298 (ARP45873_P050) antibody is Catalog # AAP45873 (Previous Catalog # AAPS17104)
Datasheets/Manuals:
Printable datasheet for anti-CFAP298 (ARP45873_P050) antibody
Sample Type Confirmation:

C21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Denoeud,F., (2007) Genome Res. 17 (6), 746-759
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...