CFAP298 Antibody - N-terminal region (ARP45873_P050)

Catalog No: ARP45873_P050

WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateC21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat

WB Suggested Anti-C21orf59 Antibody Titration: 5% Milk
ELISA Titer: dilution: 1:500
Positive Control: human LCL and mouse brains

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CFAP298 (ARP45873_P050) antibody is Catalog # AAP45873 (Previous Catalog # AAPS17104)
• Sample Type Confirmation:

  C21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Denoeud,F., (2007) Genome Res. 17 (6), 746-759
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Target Info

• Gene Symbol: CFAP298
• Gene Full Name: cilia and flagella associated protein 298
• Alias Symbols: Kur, FBB18, CILD26, C21orf48, C21orf59
• NCBI Gene Id: 56683
• Protein Name: cilia- and flagella-associated protein 298
• Description of Target: This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene.
• Uniprot ID: P57076
• Protein Accession #: NP_067077
• Nucleotide Accession #: NM_021254
• Protein Size (# AA): 290
• Molecular Weight: 33kDa
• Protein Interactions: BAG3; LYN; UBC; APP; SUMO2; MAPK6;