- Gene Symbol:
- CFAP298
- NCBI Gene Id:
- 56683
- Official Gene Full Name:
- cilia and flagella associated protein 298
- Protein Name:
- cilia- and flagella-associated protein 298
- Swissprot Id:
- P57076
- Protein Accession #:
- NP_067077
- Nucleotide Accession #:
- NM_021254
- Alias Symbols:
- Kur, FBB18, CILD26, C21orf48, C21orf59
- Replacement Item:
- This antibody may replace item sc-365454 from Santa Cruz Biotechnology.
- Description of Target:
- This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene.
- Protein Size (# AA):
- 290
- Molecular Weight:
- 33kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CFAP298.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CFAP298.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
- Complete computational species homology data:
- Anti-C21orf59 (ARP45873_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- BAG3; LYN; UBC; APP; SUMO2; MAPK6;
- Blocking Peptide:
- For anti-CFAP298 (ARP45873_P050) antibody is Catalog # AAP45873 (Previous Catalog # AAPS17104)
- Datasheets/Manuals:
- Printable datasheet for anti-CFAP298 (ARP45873_P050) antibody
- Sample Type Confirmation:
C21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat
- Target Reference:
- Denoeud,F., (2007) Genome Res. 17 (6), 746-759
- Publications:
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
