Search Antibody, Protein, and ELISA Kit Solutions

CFAP20 Antibody - middle region (ARP34302_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34302_P050-FITC Conjugated

ARP34302_P050-HRP Conjugated

ARP34302_P050-Biotin Conjugated

Gene Symbol:
CFAP20
NCBI Gene Id:
29105
Official Gene Full Name:
cilia and flagella associated protein 20
Protein Name:
cilia- and flagella-associated protein 20
Swissprot Id:
Q9Y6A4
Protein Accession #:
NP_037374
Nucleotide Accession #:
NM_013242
Alias Symbols:
GTL3, BUG22, EVORF, fSAP23, C16orf80
Replacement Item:
This antibody may replace item sc-82621 from Santa Cruz Biotechnology.
Protein Size (# AA):
193
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP20.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP20.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human C16orf80
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-C16orf80 (ARP34302_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BMI1; TFCP2L1; UBC; SF3A2; YWHAG;
Blocking Peptide:
For anti-CFAP20 (ARP34302_P050) antibody is Catalog # AAP34302 (Previous Catalog # AAPP05652)
Datasheets/Manuals:
Printable datasheet for anti-CFAP20 (ARP34302_P050) antibody
Sample Type Confirmation:

C16orf80 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Jin,J., (2004) Curr. Biol. 14 (16), 1436-1450
Publications:

Laligné, C. et al. Bug22p, a conserved centrosomal/ciliary protein also present in higher plants, is required for an effective ciliary stroke in Paramecium. Eukaryot. Cell 9, 645-55 (2010). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20118210

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...