CETN2 Antibody - middle region (ARP78309_P050)

Catalog No: ARP78309_P050

Host: Rabbit
Target Name: CETN2
Sample Tissue: HT1080 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CETN2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CETN2 (ARP78309_P050) antibody is Catalog # AAP78309

Target Info

• Gene Symbol: CETN2
• Gene Full Name: centrin 2
• Alias Symbols: CALT, CEN2
• NCBI Gene Id: 1069
• Protein Name: centrin-2
• Description of Target: Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.
• Uniprot ID: P41208
• Protein Accession #: NP_004335.1
• Nucleotide Accession #: NM_004344.1
• Protein Size (# AA): 172
• Molecular Weight: 18 kDa