Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42158_P050-FITC Conjugated

ARP42158_P050-HRP Conjugated

ARP42158_P050-Biotin Conjugated

CES2 Antibody - C-terminal region (ARP42158_P050)

Catalog#: ARP42158_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item HPA018897
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CES2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 83%; Rat: 83%
Complete computational species homology data Anti-CES2 (ARP42158_P050)
Peptide Sequence Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CES2 (ARP42158_P050) antibody is Catalog # AAP42158 (Previous Catalog # AAPS11907)
Datasheets/Manuals Printable datasheet for anti-CES2 (ARP42158_P050) antibody
Sample Type Confirmation

CES2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Gene Symbol CES2
Official Gene Full Name Carboxylesterase 2
Alias Symbols CE-2, iCE, PCE-2, CES2A1
NCBI Gene Id 8824
Protein Name Cocaine esterase
Description of Target Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Swissprot Id O00748
Protein Accession # NP_003860
Nucleotide Accession # NM_003869
Protein Size (# AA) 623
Molecular Weight 69kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CES2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CES2.
  1. What is the species homology for "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Human, Mouse, Rat".

  2. How long will it take to receive "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CES2 Antibody - C-terminal region (ARP42158_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    This target may also be called "CE-2, iCE, PCE-2, CES2A1" in publications.

  5. What is the shipping cost for "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CES2 Antibody - C-terminal region (ARP42158_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CES2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CES2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CES2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CES2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CES2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CES2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CES2 Antibody - C-terminal region (ARP42158_P050)
Your Rating
We found other products you might like!