Search Antibody, Protein, and ELISA Kit Solutions

CES2 Antibody - C-terminal region (ARP42158_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP42158_P050-FITC Conjugated

ARP42158_P050-HRP Conjugated

ARP42158_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item HPA018897
The immunogen is a synthetic peptide directed towards the C terminal region of human CES2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 83%; Rat: 83%
Complete computational species homology data:
Anti-CES2 (ARP42158_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CES2 (ARP42158_P050) antibody is Catalog # AAP42158 (Previous Catalog # AAPS11907)
Printable datasheet for anti-CES2 (ARP42158_P050) antibody
Sample Type Confirmation:

CES2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65
Gene Symbol:
Official Gene Full Name:
Carboxylesterase 2
Alias Symbols:
CE-2, iCE, PCE-2, CES2A1
NCBI Gene Id:
Protein Name:
Cocaine esterase
Description of Target:
Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CES2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CES2.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...