Size:100 ul
$125.00
In stock
SKU
ARP39538_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39538_P050-FITC Conjugated

ARP39538_P050-HRP Conjugated

ARP39538_P050-Biotin Conjugated

CERS2 Antibody (ARP39538_P050)

Catalog#: ARP39538_P050
Domestic: within 1 week delivery International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-CERS2 (ARP39538_P050)
Peptide Sequence Synthetic peptide located within the following region: SMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-CERS2 (ARP39538_P050) antibody
Publications

Montgomery, MK; Brown, SH; Lim, XY; Fiveash, CE; Osborne, B; Bentley, NL; Braude, JP; Mitchell, TW; Coster, AC; Don, AS; Cooney, GJ; Schmitz-Peiffer, C; Turner, N; Regulation of glucose homeostasis and insulin action by ceramide acyl-chain length: A beneficial role for very long-chain sphingolipid species. 1861, 1828-1839 (2016). Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27591968

Gene Symbol CERS2
Official Gene Full Name ceramide synthase 2
Alias Symbols L3, LASS2, SP260, TMSG1,
NCBI Gene Id 29956
Protein Name Ceramide synthase 2
Description of Target This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
Swissprot Id Q96G23
Protein Accession # NP_071358
Nucleotide Accession # NM_022075
Protein Size (# AA) 380
Molecular Weight 45 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CERS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CERS2.
Protein Interactions HSP90AA1; ELOVL3; ELOVL7; ELOVL6; ELOVL1; ELOVL5; ELOVL2; HSD17B12; TECR; ELOVL4; vpu; SLC39A1; SLC19A2; UBC; TMBIM6; SLC22A1; PEX6; ATP6V0C; ASGR2; ASGR1; FLOT1; FUBP1; NDN;
Write Your Own Review
You're reviewing:CERS2 Antibody (ARP39538_P050)
Your Rating