Search Antibody, Protein, and ELISA Kit Solutions

CERS2 Antibody (ARP39538_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39538_P050-FITC Conjugated

ARP39538_P050-HRP Conjugated

ARP39538_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ceramide synthase 2
NCBI Gene Id:
Protein Name:
Ceramide synthase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
L3, LASS2, SP260, TMSG1,
Description of Target:
This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
Protein Size (# AA):
Molecular Weight:
45 kDa
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CERS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CERS2.
The immunogen is a synthetic peptide directed towards the following sequence SMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAA
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-CERS2 (ARP39538_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
Available upon request
Printable datasheet for anti-CERS2 (ARP39538_P050) antibody

Montgomery, MK; Brown, SH; Lim, XY; Fiveash, CE; Osborne, B; Bentley, NL; Braude, JP; Mitchell, TW; Coster, AC; Don, AS; Cooney, GJ; Schmitz-Peiffer, C; Turner, N; Regulation of glucose homeostasis and insulin action by ceramide acyl-chain length: A beneficial role for very long-chain sphingolipid species. 1861, 1828-1839 (2016). Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27591968

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...