CEP57 Antibody - middle region (ARP66337_P050)

Catalog No: ARP66337_P050

WB Suggested Anti-CEP57 antibody Titration: 1 ug/mL
Sample Type: Human Fetal Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CEP57
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CEP57 (ARP66337_P050) antibody is Catalog # AAP66337
• Reference: N/A

Target Info

• Gene Symbol: CEP57
• Alias Symbols: MVA2, PIG8, TSP57
• NCBI Gene Id: 9702
• Description of Target: This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerization, and the C-terminal half is required for nucleating, bundling and anchoring microtubules to the centrosomes. This protein specifically interacts with fibroblast growth factor 2 (FGF2), sorting nexin 6, Ran-binding protein M and the kinesins KIF3A and KIF3B, and thus mediates the nuclear translocation and mitogenic activity of the FGF2. It also interacts with cyclin D1 and controls nucleocytoplasmic distribution of the cyclin D1 in quiescent cells. This protein is crucial for maintaining correct chromosomal number during cell division. Mutations in this gene cause mosaic variegated aneuploidy syndrome, a rare autosomal recessive disorder. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q86XR8-3
• Protein Size (# AA): 270
• Molecular Weight: 29 kDa