Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CEP55 Antibody - middle region (ARP46271_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46271_P050-FITC Conjugated

ARP46271_P050-HRP Conjugated

ARP46271_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Centrosomal protein 55kDa
NCBI Gene Id:
Protein Name:
Centrosomal protein of 55 kDa
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C10orf3, FLJ10540, URCC6, CT111
Replacement Item:
This antibody may replace item sc-134623 from Santa Cruz Biotechnology.
Description of Target:
CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CEP55.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CEP55.
The immunogen is a synthetic peptide directed towards the middle region of human CEP55
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Complete computational species homology data:
Anti-CEP55 (ARP46271_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CEP55 (ARP46271_P050) antibody is Catalog # AAP46271 (Previous Catalog # AAPS17607)
Printable datasheet for anti-CEP55 (ARP46271_P050) antibody
Target Reference:
Morita,E., (2007) EMBO J. 26 (19), 4215-4227

Chang, Y.-C. et al. Characterization of centrosomal proteins Cep55 and pericentrin in intercellular bridges of mouse testes. J. Cell. Biochem. 109, 1274-85 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast 20186884

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...