Loading...
Catalog No: ARP46271_P050
Price: $0.00
SKU
ARP46271_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CEP55 (ARP46271_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CEP55
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Peptide SequenceSynthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CEP55 (ARP46271_P050) antibody is Catalog # AAP46271 (Previous Catalog # AAPS17607)
ReferenceMorita,E., (2007) EMBO J. 26 (19), 4215-4227
Publications

Chang, Y.-C. et al. Characterization of centrosomal proteins Cep55 and pericentrin in intercellular bridges of mouse testes. J. Cell. Biochem. 109, 1274-85 (2010). 20186884

Gene SymbolCEP55
Gene Full NameCentrosomal protein 55kDa
Alias SymbolsCT111, MARCH, URCC6, C10orf3
NCBI Gene Id55165
Protein NameCentrosomal protein of 55 kDa
Description of TargetCEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
Uniprot IDQ53EZ4
Protein Accession #NP_060601
Nucleotide Accession #NM_018131
Protein Size (# AA)464
Molecular Weight54kDa
Protein InteractionsPEF1; GOLGA8DP; MIA3; CEP57L1; CCBE1; SSX2IP; HAUS1; MAPK1IP1L; FBF1; RBM17; MUM1; EIF1AD; RCOR3; RBM22; PLEKHG6; CEP55; FAM90A1; VPS37C; C1orf109; CCHCR1; CCDC53; POLM; PPP1R16B; PTPN23; SNW1; ARHGEF15; TFG; PDCD6IP; MORF4L2; FXR2; CDC45; TCL1A; UBC; TSG
  1. What is the species homology for "CEP55 Antibody - middle region (ARP46271_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast".

  2. How long will it take to receive "CEP55 Antibody - middle region (ARP46271_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CEP55 Antibody - middle region (ARP46271_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CEP55 Antibody - middle region (ARP46271_P050)"?

    This target may also be called "CT111, MARCH, URCC6, C10orf3" in publications.

  5. What is the shipping cost for "CEP55 Antibody - middle region (ARP46271_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CEP55 Antibody - middle region (ARP46271_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CEP55 Antibody - middle region (ARP46271_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CEP55 Antibody - middle region (ARP46271_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CEP55"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CEP55"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CEP55"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CEP55"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CEP55"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CEP55"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CEP55 Antibody - middle region (ARP46271_P050)
Your Rating
We found other products you might like!