Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP46271_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46271_P050-FITC Conjugated

ARP46271_P050-HRP Conjugated

ARP46271_P050-Biotin Conjugated

CEP55 Antibody - middle region (ARP46271_P050)

Catalog#: ARP46271_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134623 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CEP55
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Complete computational species homology data Anti-CEP55 (ARP46271_P050)
Peptide Sequence Synthetic peptide located within the following region: TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CEP55 (ARP46271_P050) antibody is Catalog # AAP46271 (Previous Catalog # AAPS17607)
Datasheets/Manuals Printable datasheet for anti-CEP55 (ARP46271_P050) antibody
Target Reference Morita,E., (2007) EMBO J. 26 (19), 4215-4227
Publications

Chang, Y.-C. et al. Characterization of centrosomal proteins Cep55 and pericentrin in intercellular bridges of mouse testes. J. Cell. Biochem. 109, 1274-85 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast 20186884

Gene Symbol CEP55
Official Gene Full Name Centrosomal protein 55kDa
Alias Symbols C10orf3, FLJ10540, URCC6, CT111
NCBI Gene Id 55165
Protein Name Centrosomal protein of 55 kDa
Description of Target CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
Swissprot Id Q53EZ4
Protein Accession # NP_060601
Nucleotide Accession # NM_018131
Protein Size (# AA) 464
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CEP55.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CEP55.
Protein Interactions PEF1; GOLGA8DP; MIA3; CEP57L1; CCBE1; SSX2IP; HAUS1; MAPK1IP1L; FBF1; RBM17; MUM1; EIF1AD; RCOR3; RBM22; PLEKHG6; CEP55; FAM90A1; VPS37C; C1orf109; CCHCR1; CCDC53; POLM; PPP1R16B; PTPN23; SNW1; ARHGEF15; TFG; PDCD6IP; MORF4L2; FXR2; CDC45; TCL1A; UBC; TSG
Write Your Own Review
You're reviewing:CEP55 Antibody - middle region (ARP46271_P050)
Your Rating