SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP70015_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP70015_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-CENPT (ARP70015_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human CENPT
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 85%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CENPT (ARP70015_P050-HRP) antibody is Catalog # AAP70015
Sample Type Confirmation

CENPT is supported by BioGPS gene expression data to be expressed in HepG2

Gene SymbolCENPT
Alias SymbolsSSMGA, CENP-T, C16orf56
NCBI Gene Id80152
Protein NameCentromere protein T
Description of TargetThe centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA replaces histone H3. CENPT is an additional factor required for centromere assembly.
Uniprot IDQ96BT3
Protein Accession #NP_079358
Nucleotide Accession #NM_025082
Protein Size (# AA)561
Molecular Weight60kDa
Protein InteractionsCENPW; COPS5; UBC; CENPM; CENPA; APP; CENPU; TCEA2; PPCDC; DHX29; SNCB;
  1. What is the species homology for "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    This target may also be called "SSMGA, CENP-T, C16orf56" in publications.

  5. What is the shipping cost for "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CENPT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CENPT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CENPT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CENPT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CENPT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CENPT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CENPT Antibody - C-terminal region : HRP (ARP70015_P050-HRP)
Your Rating
We found other products you might like!