CENPT Antibody - C-terminal region (ARP70015_P050)

Catalog No: ARP70015_P050

Host: Rabbit
Target Name: CENPT
Sample Type: HepG2 Whole Cell lysates
Antibody Dilution: 1.0ug/mlCENPT is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CENPT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 85%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CENPT (ARP70015_P050) antibody is Catalog # AAP70015
• Sample Type Confirmation:

  CENPT is supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: CENPT
• Alias Symbols: SSMGA, CENP-T, C16orf56
• NCBI Gene Id: 80152
• Protein Name: Centromere protein T
• Description of Target: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA replaces histone H3. CENPT is an additional factor required for centromere assembly.
• Uniprot ID: Q96BT3
• Protein Accession #: NP_079358
• Nucleotide Accession #: NM_025082
• Protein Size (# AA): 561
• Molecular Weight: 60kDa
• Protein Interactions: CENPW; COPS5; UBC; CENPM; CENPA; APP; CENPU; TCEA2; PPCDC; DHX29; SNCB;