Catalog No: ARP57121_P050
Price: $0.00
SKU
ARP57121_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CENPQ (ARP57121_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CENPQ (ARP57121_P050) antibody is Catalog # AAP57121 (Previous Catalog # AAPP40715)
Sample Type Confirmation

CENPQ is supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Reference0
Gene SymbolCENPQ
Gene Full NameCentromere protein Q
Alias SymbolsCENP-Q, C6orf139
NCBI Gene Id55166
Protein NameCentromere protein Q
Description of TargetCENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).
Uniprot IDQ7L2Z9
Protein Accession #NP_060602
Nucleotide Accession #NM_018132
Protein Size (# AA)268
Molecular Weight30kDa
Protein InteractionsUBC; KDM1A; C19orf57; CENPU; CENPM; CENPN; APP; CENPP; CENPO; CENPQ; PLK1;
  1. What is the species homology for "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CENPQ Antibody - N-terminal region (ARP57121_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    This target may also be called "CENP-Q, C6orf139" in publications.

  5. What is the shipping cost for "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CENPQ Antibody - N-terminal region (ARP57121_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CENPQ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CENPQ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CENPQ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CENPQ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CENPQ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CENPQ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CENPQ Antibody - N-terminal region (ARP57121_P050)
Your Rating