Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP54412_P050
Price: $0.00
SKU
ARP54412_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CENPP (ARP54412_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CENPP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 77%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-CENPP (ARP54412_P050) antibody is Catalog # AAP54412 (Previous Catalog # AAPP31187)
ReferenceOkada,M., (2006) Nat. Cell Biol. 8 (5), 446-457
Gene SymbolCENPP
Gene Full NameCentromere protein P
Alias SymbolsCENP-P
NCBI Gene Id401541
Protein NameCentromere protein P
Description of TargetCENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1104 CR592049.1 1-1104 1105-1633 BC071726.1 622-1150 1634-1689 BX537851.1 972-1027 1690-3411 AK091247.1 839-2560 3412-3428 AL833701.1 3078-3094
Uniprot IDQ6IPU0
Protein Accession #NP_001012267
Nucleotide Accession #NM_001012267
Protein Size (# AA)288
Molecular Weight33kDa
Protein InteractionsKLC3; ZNF341; USHBP1; CCDC33; CENPO; TEX11; RPIA; NHLH1; GOLGA2; CENPU; CENPM; CENPN; CENPH; CENPQ; ITGB3BP; CENPI; UBC;
  1. What is the species homology for "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Horse".

  2. How long will it take to receive "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CENPP Antibody - N-terminal region (ARP54412_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    This target may also be called "CENP-P" in publications.

  5. What is the shipping cost for "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CENPP Antibody - N-terminal region (ARP54412_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CENPP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CENPP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CENPP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CENPP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CENPP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CENPP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CENPP Antibody - N-terminal region (ARP54412_P050)
Your Rating