CELF2 Antibody - N-terminal region (ARP40324_P050)

Catalog No: ARP40324_P050

Host: Rabbit
Target Name: CELF2
Sample Tissue: Human U937 Whole Cell lysates
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: CELF2
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Host: Rabbit
Target Name: CELF2
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlCELF2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Host: Rabbit
Target Name: CELF2
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: CELF2
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: CELF2
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CELF2
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CELF2 (ARP40324_P050) antibody is Catalog # AAP40324
• Sample Type Confirmation:

  CELF2 is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat

• Reference: Subramaniam,D., Am. J. Physiol. Gastrointest. Liver Physiol. 294 (4), G1025-G1032

Target Info

• Gene Symbol: CELF2
• Gene Full Name: CUGBP, Elav-like family member 2
• Alias Symbols: ETR3, ETR-3, NAPOR, CELF-2, CUGBP2, BRUNOL3, CUG-BP2
• NCBI Gene Id: 10659
• Protein Name: CUGBP Elav-like family member 2
• Description of Target: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: O95319
• Protein Accession #: NP_001313248
• Nucleotide Accession #: NM_001326319.1
• Protein Size (# AA): 508
• Molecular Weight: 55 kDa
• Protein Interactions: PTGS2; ELAVL1; UBC; FN1; APP; PCBP1; A1CF; APOBEC1; Apob;