SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38679_P050
Price: $0.00
SKU
ARP38679_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CEBPZ Antibody - N-terminal region (ARP38679_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CEBPZ (ARP38679_P050) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CEBPZ
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Horse: 80%; Human: 100%; Mouse: 80%; Pig: 77%; Rabbit: 85%; Rat: 82%; Yeast: 83%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CEBPZ (ARP38679_P050) antibody is Catalog # AAP38679
Gene SymbolCEBPZ
Gene Full NameCCAAT enhancer binding protein zeta
Alias SymbolsCBF, CBF2, NOC1, HSP-CBF
NCBI Gene Id10153
Protein NameCCAAT/enhancer-binding protein zeta
Description of TargetThis gene belongs to the CEBP family. The encoded protein plays a role in cellular response to environmental stimuli through a transcriptional process that involves heat shock factors, conserved DNA elements (heat shock elements or HSEs) and CCAAT boxes. The protein acts as a DNA-binding transcriptional activator and regulates the heat-shock protein 70 (HSP70) promoter in a CCAAT-dependent manner. The protein is also involved in cell growth and differentiation, particularly, hematopoietic differentiation. Methylation of the promoter of this gene or mutations within the gene may be correlated with occurance of acute myeloid leukemia (AML).
Uniprot IDQ03701
Protein Accession #NP_005751
Nucleotide Accession #NM_005760.3
Protein Size (# AA)1054
Molecular Weight115 kDa
Protein InteractionsUBC; TARBP2; EED; RNF2; HDAC11; SIRT7; SUMO2; RELA; RPS6KA6; LAMTOR3; PRKRA; UBE3A; HMOX2; GSK3B; ZBTB7B; LZTR1; STAT6; RXRG; PCBD1; TP73; TP53; NFYB; LAG3;
  1. What is the species homology for "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CEBPZ Antibody - N-terminal region (ARP38679_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    This target may also be called "CBF, CBF2, NOC1, HSP-CBF" in publications.

  5. What is the shipping cost for "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "115 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CEBPZ Antibody - N-terminal region (ARP38679_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CEBPZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CEBPZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CEBPZ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CEBPZ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CEBPZ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CEBPZ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CEBPZ Antibody - N-terminal region (ARP38679_P050)
Your Rating
We found other products you might like!