CEACAM6 Antibody - middle region : FITC (ARP41504_T100-FITC)

Catalog No: ARP41504_T100-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CEACAM6
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CEACAM6 (ARP41504_T100-FITC) antibody is Catalog # AAP41504 (Previous Catalog # AAPS09602)
• Reference: Muenzner,P., (2005) J. Cell Biol. 170 (5), 825-836
• Publications:

  Kobayashi, M. et al. Carcinoembryonic antigen-related cell adhesion molecules as surrogate markers for EGFR inhibitor sensitivity in human lung adenocarcinoma. Br. J. Cancer 107, 1745-53 (2012). IHC, Human 23099808

Target Info

• Gene Symbol: CEACAM6
• Gene Full Name: Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
• Alias Symbols: NCA, CEAL, CD66c
• NCBI Gene Id: 4680
• Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 6
• Description of Target: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
• Uniprot ID: P40199
• Protein Accession #: NP_002474
• Nucleotide Accession #: NM_002483
• Protein Size (# AA): 344
• Molecular Weight: 38kDa
• Protein Interactions: CARTPT; CEACAM6; CEACAM8; CEACAM7; CEACAM5; CEACAM1; APP;