Search Antibody, Protein, and ELISA Kit Solutions

CEACAM6 antibody - middle region (ARP41504_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41504_T100-FITC Conjugated

ARP41504_T100-HRP Conjugated

ARP41504_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
Protein Name:
Carcinoembryonic antigen-related cell adhesion molecule 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-17068 from Santa Cruz Biotechnology.
Description of Target:
Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CEACAM6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CEACAM6.
The immunogen is a synthetic peptide directed towards the middle region of human CEACAM6
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CEACAM6 (ARP41504_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CEACAM6 (ARP41504_T100) antibody is Catalog # AAP41504 (Previous Catalog # AAPS09602)
Printable datasheet for anti-CEACAM6 (ARP41504_T100) antibody
Target Reference:
Muenzner,P., (2005) J. Cell Biol. 170 (5), 825-836

Kobayashi, M. et al. Carcinoembryonic antigen-related cell adhesion molecules as surrogate markers for EGFR inhibitor sensitivity in human lung adenocarcinoma. Br. J. Cancer 107, 1745-53 (2012). IHC, WB, Human 23099808

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...