CEACAM3 Recombinant Protein (Human) (OPCA05112)

Catalog No: OPCA05112

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
• Protein Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 35-155 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes. Streichert T., Ebrahimnejad A., Ganzer S., Flayeh R., Wagener C., Bruemmer J. Biochem. Biophys. Res. Commun. 289:191-197(2001)

Target Info

• Gene Symbol: CEACAM3
• Gene Full Name: CEA cell adhesion molecule 3
• Alias Symbols: carcinoembryonic antigen CGM1;carcinoembryonic antigen gene family member 1;carcinoembryonic antigen related cell adhesion molecule 3;carcinoembryonic antigen-related cell adhesion molecule 3;CD66D;CD66d antigen;CEA;CGM1;nonspecific cross-reacting antigen;W264;W282.
• NCBI Gene Id: 1084
• Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 3
• Description of Target: Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
• Uniprot ID: P40198
• Protein Size (# AA): Recombinant
• Molecular Weight: 29.1 kDa