CEACAM3 Antibody - C-terminal region (ARP60120_P050)

Catalog No: ARP60120_P050

WB Suggested Anti-CEACAM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CEACAM3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CEACAM3 (ARP60120_P050) antibody is Catalog # AAP60120 (Previous Catalog # AAPP46258)

Target Info

• Gene Symbol: CEACAM3
• Gene Full Name: Carcinoembryonic antigen-related cell adhesion molecule 3
• Alias Symbols: CEA, CGM1, W264, W282, CD66D
• NCBI Gene Id: 1084
• Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 3
• Description of Target: This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
• Uniprot ID: P40198
• Protein Accession #: NP_001806
• Nucleotide Accession #: NM_001815
• Protein Size (# AA): 252
• Molecular Weight: 23kDa
• Protein Interactions: CSNK1A1L; SRC; S100A8; CEACAM1;