Search Antibody, Protein, and ELISA Kit Solutions

CDYL Antibody - N-terminal region (ARP49096_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49096_P050-FITC Conjugated

ARP49096_P050-HRP Conjugated

ARP49096_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Chromodomain protein, Y-like
NCBI Gene Id:
Protein Name:
Chromodomain Y-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CDYL1, DKFZP586C1622, MGC131936
Replacement Item:
This antibody may replace item sc-28468 from Santa Cruz Biotechnology.
Description of Target:
CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDYL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDYL.
The immunogen is a synthetic peptide directed towards the n terminal region of human CDYL
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-CDYL (ARP49096_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CDYL (ARP49096_P050) antibody is Catalog # AAP49096 (Previous Catalog # AAPY02282)
Printable datasheet for anti-CDYL (ARP49096_P050) antibody
Target Reference:
Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396

Li, J. et al. A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells. FEBS Lett. 584, 3198-202 (2010). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20547158

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...