Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49096_P050-FITC Conjugated

ARP49096_P050-HRP Conjugated

ARP49096_P050-Biotin Conjugated

CDYL Antibody - N-terminal region (ARP49096_P050)

Catalog#: ARP49096_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IF, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-28468 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human CDYL
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Complete computational species homology data Anti-CDYL (ARP49096_P050)
Peptide Sequence Synthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CDYL (ARP49096_P050) antibody is Catalog # AAP49096 (Previous Catalog # AAPY02282)
Datasheets/Manuals Printable datasheet for anti-CDYL (ARP49096_P050) antibody
Target Reference Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396

Li, J. et al. A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells. FEBS Lett. 584, 3198-202 (2010). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20547158

Gene Symbol CDYL
Official Gene Full Name Chromodomain protein, Y-like
Alias Symbols CDYL1, DKFZP586C1622, MGC131936
NCBI Gene Id 9425
Protein Name Chromodomain Y-like protein
Description of Target CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.
Swissprot Id Q9Y232
Protein Accession # NP_004815
Nucleotide Accession # NM_004824
Protein Size (# AA) 544
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CDYL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CDYL.
Write Your Own Review
You're reviewing:CDYL Antibody - N-terminal region (ARP49096_P050)
Your Rating