- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-CDY1 (ARP48645_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CDY1 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 86%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-CDY1 (ARP48645_T100) antibody is Catalog # AAP48645 (Previous Catalog # AAPS23812) |
Reference | Stouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199 |
---|---|
Gene Symbol | CDY1 |
Gene Full Name | Chromodomain protein, Y-linked, 1 |
Alias Symbols | CDY, CDY1A |
NCBI Gene Id | 9085 |
Protein Name | cDNA FLJ76680, highly similar to Homo sapiens chromodomain protein, Y-linked, 1 (CDY1), transcript variant 2, mRNA EMBL BAF85007.1 |
Description of Target | CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. Two protein isoforms are encoded by transcript variants of this gene. Additional transcript variants have been described, but their full-length nature has not been determined. |
Uniprot ID | A8K8F3 |
Protein Accession # | NP_004671 |
Nucleotide Accession # | NM_004680 |
Protein Size (# AA) | 554 |
Molecular Weight | 62kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse".
-
How long will it take to receive "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CDY1 Antibody - C-terminal region (ARP48645_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
This target may also be called "CDY, CDY1A" in publications.
-
What is the shipping cost for "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "62kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CDY1 Antibody - C-terminal region (ARP48645_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CDY1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CDY1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CDY1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CDY1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CDY1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CDY1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.