Search Antibody, Protein, and ELISA Kit Solutions

CDY1 Antibody - C-terminal region (ARP48645_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48645_T100-FITC Conjugated

ARP48645_T100-HRP Conjugated

ARP48645_T100-Biotin Conjugated

Gene Symbol:
CDY1
Official Gene Full Name:
Chromodomain protein, Y-linked, 1
NCBI Gene Id:
9085
Protein Name:
cDNA FLJ76680, highly similar to Homo sapiens chromodomain protein, Y-linked, 1 (CDY1), transcript variant 2, mRNA EMBL BAF85007.1
Swissprot Id:
A8K8F3
Protein Accession #:
NP_004671
Nucleotide Accession #:
NM_004680
Alias Symbols:
CDY, CDY1A
Replacement Item:
This antibody may replace item sc-28468 from Santa Cruz Biotechnology.
Description of Target:
CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. Two protein isoforms are encoded by transcript variants of this gene. Additional transcript variants have been described, but their full-length nature has not been determined.
Protein Size (# AA):
554
Molecular Weight:
62kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDY1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CDY1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 86%; Rat: 93%
Complete computational species homology data:
Anti-CDY1 (ARP48645_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CDY1 (ARP48645_T100) antibody is Catalog # AAP48645 (Previous Catalog # AAPS23812)
Datasheets/Manuals:
Printable datasheet for anti-CDY1 (ARP48645_T100) antibody
Target Reference:
Stouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...