Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CDX2 Antibody - middle region (ARP31476_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31476_P050-FITC Conjugated

ARP31476_P050-HRP Conjugated

ARP31476_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Caudal type homeobox 2
NCBI Gene Id:
Protein Name:
Homeobox protein CDX-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130716 from Santa Cruz Biotechnology.
Description of Target:
CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDX2.
The immunogen is a synthetic peptide directed towards the middle region of human CDX2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CDX2 (ARP31476_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CDX2 (ARP31476_P050) antibody is Catalog # AAP31476 (Previous Catalog # AAPP02238)
Printable datasheet for anti-CDX2 (ARP31476_P050) antibody
Target Reference:
Saad,R.S., et al., (2004) J. Clin. Pathol. 122 (3), 421-427

Tajbakhsh, J. Covisualization of methylcytosine, global DNA, and protein biomarkers for In Situ 3D DNA methylation phenotyping of stem cells. Methods Mol. Biol. 1052, 77-88 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23593143

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...