Size:100 ul
$289.00
In Stock
SKU
ARP31476_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31476_P050-FITC Conjugated

ARP31476_P050-HRP Conjugated

ARP31476_P050-Biotin Conjugated

CDX2 Antibody - middle region (ARP31476_P050)

Catalog#: ARP31476_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130716 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDX2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-CDX2 (ARP31476_P050)
Peptide Sequence Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CDX2 (ARP31476_P050) antibody is Catalog # AAP31476 (Previous Catalog # AAPP02238)
Datasheets/Manuals Printable datasheet for anti-CDX2 (ARP31476_P050) antibody
Target Reference Saad,R.S., et al., (2004) J. Clin. Pathol. 122 (3), 421-427
Publications

Tajbakhsh, J. Covisualization of methylcytosine, global DNA, and protein biomarkers for In Situ 3D DNA methylation phenotyping of stem cells. Methods Mol. Biol. 1052, 77-88 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23593143

Gene Symbol CDX2
Official Gene Full Name Caudal type homeobox 2
Alias Symbols CDX3, CDX-3
NCBI Gene Id 1045
Protein Name Homeobox protein CDX-2
Description of Target CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus.
Swissprot Id Q99626
Protein Accession # NP_001256
Nucleotide Accession # NM_001265
Protein Size (# AA) 313
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CDX2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CDX2.
Protein Interactions CDK2; SMARCD1; SMARCB1; SMARCA4; SMARCA2; KDM5B; UBB; PAX6; GSK3B; EP300; CDX2; MAPK14; CREBBP; MAPK1; HNF1A; ACAT2;
  1. What is the species homology for "CDX2 Antibody - middle region (ARP31476_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "CDX2 Antibody - middle region (ARP31476_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CDX2 Antibody - middle region (ARP31476_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CDX2 Antibody - middle region (ARP31476_P050)"?

    This target may also be called "CDX3, CDX-3" in publications.

  5. What is the shipping cost for "CDX2 Antibody - middle region (ARP31476_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CDX2 Antibody - middle region (ARP31476_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CDX2 Antibody - middle region (ARP31476_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CDX2 Antibody - middle region (ARP31476_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CDX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CDX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CDX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CDX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CDX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CDX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CDX2 Antibody - middle region (ARP31476_P050)
Your Rating