CDTB Recombinant Protein (Escherichia coli) (OPCA04607)

Catalog No: OPCA04607

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Escherichia coli
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
• Protein Sequence: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 19-269 aa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Reference: Cloning, sequencing, and expression of the Escherichia coli cytolethal distending toxin genes.Pickett C.L., Cottle D.L., Pesci E.C., Bikah G.Infect. Immun. 62:1046-1051(1994)

Target Info

• Gene Symbol: CDTB
• Alias Symbols: Deoxyribonuclease CdtB.
• Protein Name: Cytolethal distending toxin subunit B
• Description of Target: Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement.
• Uniprot ID: Q46669
• Protein Size (# AA): Recombinant
• Molecular Weight: 47.4 kDa