Size:100 ul
$319.00
In stock
SKU
ARP45073_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45073_P050-FITC Conjugated

ARP45073_P050-HRP Conjugated

ARP45073_P050-Biotin Conjugated

CDS1 Antibody - middle region (ARP45073_P050)

Catalog#: ARP45073_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDS1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-CDS1 (ARP45073_P050)
Peptide Sequence Synthetic peptide located within the following region: VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CDS1 (ARP45073_P050) antibody is Catalog # AAP45073 (Previous Catalog # AAPP12361)
Datasheets/Manuals Printable datasheet for anti-CDS1 (ARP45073_P050) antibody
Sample Type Confirmation

CDS1 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Volta,M., (1999) Genomics 55 (1), 68-77
Publications

Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23872101

Gene Symbol CDS1
Official Gene Full Name CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
Alias Symbols CDS
NCBI Gene Id 1040
Protein Name Phosphatidate cytidylyltransferase 1
Description of Target Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13.
Swissprot Id Q92903
Protein Accession # NP_001254
Nucleotide Accession # NM_001263
Protein Size (# AA) 461
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CDS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CDS1.
Protein Interactions UBC; CDC25C;
Write Your Own Review
You're reviewing:CDS1 Antibody - middle region (ARP45073_P050)
Your Rating