Catalog No: ARP53629_P050
Price: $0.00
SKU
ARP53629_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CDKN3 Antibody - C-terminal region (ARP53629_P050)

Datasheets/ManualsPrintable datasheet for anti-CDKN3 (ARP53629_P050) antibody
Product Info
ReferenceOkamoto,K., (2006) Biochem. Biophys. Res. Commun. 351 (1), 216-222
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CDKN3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CDKN3 (ARP53629_P050) antibody is Catalog # AAP53629 (Previous Catalog # AAPP30469)
Gene SymbolCDKN3
Gene Full NameCyclin-dependent kinase inhibitor 3
Alias SymbolsKAP, CDI1, CIP2, KAP1
NCBI Gene Id1033
Protein NameCyclin-dependent kinase inhibitor 3
Description of TargetCDKN3 belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ16667
Protein Accession #NP_005183
Nucleotide Accession #NM_005192
Protein Size (# AA)212
Molecular Weight23kDa
Protein InteractionsCDK2; UBC; NCOA3; MS4A3; CDKN3; CDK3; CDC25A; CDK1; CEBPA;
  1. What is the species homology for "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CDKN3 Antibody - C-terminal region (ARP53629_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    This target may also be called "KAP, CDI1, CIP2, KAP1" in publications.

  5. What is the shipping cost for "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CDKN3 Antibody - C-terminal region (ARP53629_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CDKN3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CDKN3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CDKN3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CDKN3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CDKN3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CDKN3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CDKN3 Antibody - C-terminal region (ARP53629_P050)
Your Rating
We found other products you might like!