CDKN2C Antibody (ARP30196_P050)

Catalog No: ARP30196_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Rabbit Anti-CDKN2C antibody
Catalog Number: ARP30196
Formalin Fixed Paraffin Embedded Tissue: Human Skeletal Muscle
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Rabbit Anti-CDKN2C antibody
Catalog Number: ARP30196
Formalin Fixed Paraffin Embedded Tissue: Human Thymus
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: CDKN2C
• Gene Full Name: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
• Alias Symbols: p18, INK4C, p18-INK4C
• NCBI Gene Id: 1031
• Protein Name: Cyclin-dependent kinase 4 inhibitor C
• Description of Target: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.
• Uniprot ID: P42773
• Protein Accession #: NP_001253
• Nucleotide Accession #: NM_001262
• Protein Size (# AA): 168
• Molecular Weight: 18 kDa
• Protein Interactions: NIF3L1; NAGK; AHCYL1; UBC; TCF12; TCF4; REL; CDK6; CDK4; GOPC; LY96; MAPK10; MAPK8; PPP2CA; ATR; ATM; COPS6; CCDC90B; RBM48; UNC119; DRAP1; GDF9; NHP2L1; TLE1; CDKN2A; TP53; APLP1; LRIF1; QPCTL;