Search Antibody, Protein, and ELISA Kit Solutions

CDKN2B Antibody - middle region (AVARP03047_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP03047_P050-FITC Conjugated

AVARP03047_P050-HRP Conjugated

AVARP03047_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
NCBI Gene Id:
Protein Name:
Cyclin-dependent kinase 4 inhibitor B
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
P15, MTS2, TP15, CDK4I, INK4B, p15INK4b
Replacement Item:
This antibody may replace item sc-1429 from Santa Cruz Biotechnology.
Description of Target:
CDKN2B's gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. CDKN2B is a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition.
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDKN2B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDKN2B.
The immunogen is a synthetic peptide directed towards the middle region of human CDKN2B
Predicted Species Reactivity:
Human, Dog, Guinea Pig, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 91%; Guinea Pig: 83%; Mouse: 83%; Pig: 100%; Rabbit: 91%; Rat: 83%
Complete computational species homology data:
Anti-CDKN2B (AVARP03047_P050)
Peptide Sequence:
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CDKN2B (AVARP03047_P050) antibody is Catalog # AAP30194 (Previous Catalog # AAPP00351)
Printable datasheet for anti-CDKN2B (AVARP03047_P050) antibody
Target Reference:
Scott,S.A., et al., (2004) Leuk. Res. 28 (12), 1293-1301

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...