CDKN2B Antibody - middle region (AVARP03047_P050)

Catalog No: AVARP03047_P050

WB Suggested Anti-CDKN2B Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: CDKN2B
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDKN2B
• Predicted Homology Based on Immunogen Sequence: Dog: 91%; Guinea Pig: 83%; Mouse: 83%; Pig: 100%; Rabbit: 91%; Rat: 83%
• Peptide Sequence: Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDKN2B (AVARP03047_P050) antibody is Catalog # AAP30194 (Previous Catalog # AAPP00351)
• Reference: Scott,S.A., et al., (2004) Leuk. Res. 28 (12), 1293-1301

Target Info

• Gene Symbol: CDKN2B
• Gene Full Name: Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
• Alias Symbols: P15, MTS2, TP15, CDK4I, INK4B, p15INK4b
• NCBI Gene Id: 1030
• Protein Name: Cyclin-dependent kinase 4 inhibitor B
• Description of Target: CDKN2B's gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. CDKN2B is a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition.
• Uniprot ID: P42772
• Protein Accession #: NP_004927
• Nucleotide Accession #: NM_004936
• Protein Size (# AA): 138
• Molecular Weight: 15kDa
• Protein Interactions: UBC; TRAF1; CDK6; CCDC33; NIF3L1; CDK4; PYCRL; RNF20; TGFB1I1; ISL1; APP; KIAA1377; CCDC90B; ARPC3; ZBTB17; IKBKAP; CDK8; MAGEA11; PIAS2;